PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00143425001
Common NameGSBRNA2T00143425001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 237aa    MW: 26098.9 Da    PI: 7.2142
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00143425001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.99.6e-30147202158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQy++Il+RR++Rak+e e+k+   +rkpylheSRhkhA++R R+sgGrF
  GSBRNA2T00143425001 147 QEPVYVNAKQYEGILRRRKARAKAELERKV--INRKPYLHESRHKHAMKRVRASGGRF 202
                          69***************************9..89***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-31145205IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234146205IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.2E-26148202IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-23149171IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860151171IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-23179202IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MQSKSGGRGN EEEVNQQQPM MMYPDPWWKN NSFGGVLPQE RPSASESNDV HSPSEDDGGP  60
CKDSQAATSP PPPGFLEGKD QTASMDDEQV VQPPELVGHY IACVPNPYQD AYYGGMMGAY  120
GHHQPLGFRP YPGMARERTA LPLDTTQEPV YVNAKQYEGI LRRRKARAKA ELERKVINRK  180
PYLHESRHKH AMKRVRASGG RFAKKSEAEA AEDAAAARRE RSSATNSSGS EQPVDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-16146202158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186195RHKHAMKRVR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00143425001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3172991e-124AK317299.1 Arabidopsis thaliana AT5G12840 mRNA, complete cds, clone: RAFL21-66-A21.
GenBankBT0258011e-124BT025801.1 Arabidopsis thaliana At5g12840 mRNA, complete cds.
GenBankY137201e-124Y13720.1 Arabidopsis thaliana mRNA for Hap2a transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009125864.11e-151PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
SwissprotQ9LXV51e-109NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A078D8V61e-176A0A078D8V6_BRANA; BnaA02g01270D protein
STRINGBra023378.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.42e-75nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]